PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0509s0021.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 363aa    MW: 39794.1 Da    PI: 7.3092
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0509s0021.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.71.9e-26186236151
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                          k+r+ W+++LH rF++ ++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQ
  Kalax.0509s0021.1.p 186 KQRRSWSQDLHWRFLHSLQQLGGADVATPKQIRELMKVDGLTNDEVKSHLQ 236
                          79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.788183243IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-22184252IPR009057Homeodomain-like
SuperFamilySSF466892.33E-12184241IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-22186237IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MQRQGDEYVR ALETERIKML VFQRELPLSI ELVSRAIESH RQQLSSSSEE TTSDCGPGLE  60
FIPLKKPTYA SSSGSEEHQQ DLNLACVEDG SGGMDESSEK SWHKSDWLRS VQLWNQSPDP  120
PPKSEELSGE GLVAKKAKRS DNGEETKSVE EIHGQTNGSS TSETKEPQKS GGGKKEDREG  180
SLSRRKQRRS WSQDLHWRFL HSLQQLGGAD VATPKQIREL MKVDGLTNDE VKSHLQVCLK  240
NTESKYRLHT RRPAPPPSQA SGSGAHAPQF VVVGGVWAPP SDYTTMALPV PANSEGDRAS  300
GAPRSGMYTP MAAQPNHPCQ QFEFNQKPQV KSKNSESRGD GPARCISLSM SSATRSGPSP  360
VY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356299.13e-77PREDICTED: uncharacterized protein LOC103947165
TrEMBLD7T9871e-76D7T987_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03110.t013e-76(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.12e-60G2-like family protein